PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M01679.1.p
Common NameMIMGU_mgv1a003822mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 564aa    MW: 61590.9 Da    PI: 7.73
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M01679.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.77.4e-31211268260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       +DgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers   ++++ei+Y+g+H+h+k
  Migut.M01679.1.p 211 EDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-SGQITEIVYKGSHDHPK 268
                       7****************************************.9**************85 PP

2WRKY105.33.3e-33380438159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+v+g+++prsYY+Ct  gCpv+k+ver+++dpk+v++tYeg+Hnh+
  Migut.M01679.1.p 380 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNVGCPVRKHVERASHDPKAVITTYEGKHNHD 438
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-26197269IPR003657WRKY domain
SuperFamilySSF1182901.96E-24203269IPR003657WRKY domain
PROSITE profilePS5081122.619205269IPR003657WRKY domain
SMARTSM007741.3E-32210268IPR003657WRKY domain
PfamPF031061.9E-23211267IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-37365440IPR003657WRKY domain
SuperFamilySSF1182902.88E-29372440IPR003657WRKY domain
PROSITE profilePS5081138.549375440IPR003657WRKY domain
SMARTSM007745.3E-39380439IPR003657WRKY domain
PfamPF031069.1E-26381438IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MEDAHSSYSH YQHHSPPSSN NADAVGSING AKYRLMSPAK LPISRSTSIT IPPGLSPTSF  60
LDSPVLLSNI KAEPSPTTGS FFKPHLMQGS GENAALSLEK FFSGRKAVDE KTSSSFEFRF  120
QTGASSTSGL SSAGLSFHVG MNRQGPVVYQ DQHNSQPPVP SQSVVVGAHN SPIRNSIDEL  180
NQGGQSNTGN RTSSSEHKDS ISTVSNERTS EDGYNWRKYG QKLVKGSEFP RSYYKCTYPN  240
CEVKKIFERS PSGQITEIVY KGSHDHPKPQ PARRQNSGAL LSIQEDKPDK DLLFTGQEDK  300
LNNNKMEQNA SPMLSPLQTN EDNVDVSVSQ YPGLNDDVEE DDPFLKRSRK MEEGIDATPV  360
VKPIREPRVV VQTLSEVDIL DDGYRWRKYG QKVVRGNPNP RSYYKCTNVG CPVRKHVERA  420
SHDPKAVITT YEGKHNHDVP TAKNNNNNNN NNNNNNISSH DFSAQYAGAN SKLRPPQDSS  480
SGNGSISLDL GVGIGREAMD AEEGRGQIGN PASAAAQIPA YYGIVNMYGN RDNLVEGRSS  540
FQAPPMHPSN QCPPSLGRIL MGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-37201440877Probable WRKY transcription factor 4
2lex_A6e-37201440877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012848779.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
TrEMBLA0A022QFE30.0A0A022QFE3_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000766700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40252344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-144WRKY family protein